Advanced search×
  1. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels.

    FEBS Letters 579(19):4181 (2005) PMID 16038905

    We isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-...
  2. Functional and structural characterization of a novel member of the natriuretic family of peptides from the venom of Pseudocerastes persicus...

    FEBS Letters 557(1-3):104 (2004) PMID 14741349

    We conclude that PNP binds to the NPR-A receptor. The solution conformation of PNP was characterized using (1)H nuclear magnetic resonance spectroscopy and indicates a high degree of conformational flexibility....
  3. Molecular Dynamics Simulation of Interaction of a Cytotoxin with a Lipid Bilayer: A Multiscale Modeling

    Biophysical Journal 102(3):452a (2012)

  4. Publisher's Note: "Nanomechanical properties of lipid bilayer: Asymmetric modulation of lateral pressure and surface tension due to protein ...

    The Journal of Chemical Physics 138(13):139901 (2013) PMID 23574257

  5. Fibrillation of alpha-lactalbumin: effect of crocin and safranal, two natural small molecules from Crocus sativus.

    Biopolymers 93(10):854 (2010) PMID 20564050

    We investigated the inhibitory effect of crocin and safranal, two principal components of saffron, on fibrillation of apo-alpha-lactalbumin (a-alpha-LA), used as a model protein, under amyloidogenic conditions. In the absence of any ligand, formation of soluble oligomers became evident after 18 h of...
  6. How modification of accessible lysines to phenylalanine modulates the structural and functional properties of horseradish peroxidase: a simu...

    PLoS ONE 9(10):e109062 (2014) PMID 25313804 PMCID PMC4196758

    We altered these lysines to phenylalanine residues to model those chemical modifications or genetic manipulations in which these positively charged lysines are converted to aromatic hydrophobic residues. Simulation results implied that upon these substitutions, the protein structure becomes less fle...
  7. A molecular dynamics simulation study of nanomechanical properties of asymmetric lipid bilayer.

    Journal of Membrane Biology 246(1):67 (2013) PMID 23073731

    Our simulations indicate that adding more phospholipids into one monolayer results in asymmetrical changes in the lateral pressure of the individual bilayer leaflets. Interestingly, it has been observed that a change in phospholipid density in one leaflet affects the physical properties of unperturb...
  8. Structural stabilization and functional improvement of horseradish peroxidase upon modification of accessible lysines: experiments and simul...

    Biophysical Journal 92(4):1192 (2007) PMID 17114227 PMCID PMC1783884

    We previously reported that covalent attachment of an electron relay (anthraquinone 2-carboxylic acid) to the surface-exposed Lys residues successfully improves electron transfer properties of HRP. Here we investigated structural and functional consequences of this modification, which alters three a...
  9. Nanomechanical properties of lipid bilayer: asymmetric modulation of lateral pressure and surface tension due to protein insertion in one le...

    The Journal of Chemical Physics 138(6):065101 (2013) PMID 23425492

    Our simulations reveal that the insertion of CTX A3 into one monolayer results in an asymmetrical change in the lateral pressure and corresponding spatial distribution of surface tension of the individual bilayer leaflets. The relative variation in the surface tension of the two monolayers as a resu...
  10. Potent modulation of the voltage-gated sodium channel Nav1.7 by OD1, a toxin from the scorpion Odonthobuthus doriae.

    Molecular Pharmacology 70(1):405 (2006) PMID 16641312

    We investigated the effects of OD1, a scorpion toxin isolated from the venom of the scorpion Odonthobuthus doriae. Nav1.3, Nav1.7, and Nav1.8 channels were coexpressed with beta1-subunits in Xenopus laevis oocytes. Na+ currents were recorded with the two-electrode voltage-clamp technique. OD1 modula...