1. Phosphorylation modifies the molecular stability of β-amyloid deposits.

    Nature Communications 7:11359 (2016) PMID 27072999 PMCID PMC4833870

    Protein aggregation plays a crucial role in neurodegenerative diseases. A key feature of protein aggregates is their ubiquitous modification by phosphorylation. Little is known, however, about the molecular consequences of phosphorylation of protein aggregates. Here we show that phosphorylation ...
  2. Turn plasticity distinguishes different modes of amyloid-β aggregation.

    Journal of the American Chemical Society 136(13):4913 (2014) PMID 24617810

    Pathogenesis of Alzheimer's disease (AD) is associated with aggregation of the amyloid-β (Aβ) peptide into oligomeric and fibrillar assemblies; however, little is known about the molecular basis of aggregation of Aβ into distinct assembly states. Here we demonstrate that phosphorylation at serin...
  3. Molecular Interaction Between PPTI and Shakv1.1 Potassium Channel Explored by Docking and Molecular Dynamics Simulation

    Biophysical Journal 106(2):479a (2014)

  4. How modification of accessible lysines to phenylalanine modulates the structural and functional properties of horseradish peroxidase: a simulation study.

    PLoS ONE 9(10):e109062 (2014) PMID 25313804 PMCID PMC4196758

    Horseradish Peroxidase (HRP) is one of the most studied peroxidases and a great number of chemical modifications and genetic manipulations have been carried out on its surface accessible residues to improve its stability and catalytic efficiency necessary for biotechnological applications. Most ...
  5. Nanomechanical properties of lipid bilayer: asymmetric modulation of lateral pressure and surface tension due to protein insertion in one leaflet of a bilayer.

    Journal of Chemical Physics 138(6):065101 (2013) PMID 23425492

    The lipid membranes of living cells form an integral part of biological systems, and the mechanical properties of these membranes play an important role in biophysical investigations. One interesting problem to be evaluated is the effect of protein insertion in one leaflet of a bilayer on the ph...
  6. Evaluation of Inhibitory Effects of Some Natural Products on Tyrosinase Activity by Experimental and Computational Methods

    Biophysical Journal 104(2):232a (2013)

  7. A molecular dynamics simulation study of nanomechanical properties of asymmetric lipid bilayer.

    Journal of Membrane Biology 246(1):67 (2013) PMID 23073731

    A very important part of the living cells of biological systems is the lipid membrane. The mechanical properties of this membrane play an important role in biophysical studies. Investigation as to how the insertion of additional phospholipids in one leaflet of a bilayer affects the physical prop...
  8. Fibrillation of alpha-lactalbumin: effect of crocin and safranal, two natural small molecules from Crocus sativus.

    Biopolymers 93(10):854 (2010) PMID 20564050

    Formation of toxic amyloid structures is believed to be associated with various late-onset neurodegenerative disorders such as Alzheimer's and Parkinson's diseases. The fact that many proteins in addition to those that are associated with clinical conditions have the potential to form amyloid fi...
  9. Surface Modification Affects the Heme Planarity and Accessibility in Horseradish Peroxidase

    Biophysical Journal 96(3):581a (2009)

  10. Structural Evaluation of the Effects of Disulfide Bond Eliminations on Scorpion Toxin κ-Hefutoxin1 fromHeterometrus Fulvipes

    Biophysical Journal 96(3):69a (2009)

  11. Conformational changes of alpha-chymotrypsin in a fibrillation-promoting condition: a molecular dynamics study.

    Biophysical Journal 95(9):4139 (2008) PMID 18658209 PMCID PMC2567952

    Amyloid nanofibril formation appears to be a generic property of polypeptide chains. alpha-Chymotrypsin (aCT) was recently driven toward amyloid-like aggregation by the addition of trifluoroethanol (TFE) at intermediate concentrations. In this study we employed a molecular dynamics simulation to...
  12. Structural stabilization and functional improvement of horseradish peroxidase upon modification of accessible lysines: experiments and simulation.

    Biophysical Journal 92(4):1192 (2007) PMID 17114227 PMCID PMC1783884

    Horseradish peroxidase (HRP) is an important heme enzyme with enormous medical diagnostic, biosensing, and biotechnological applications. Thus, any improvement in the applicability and stability of the enzyme is potentially interesting. We previously reported that covalent attachment of an elect...
  13. Structural Stabilization and Functional Improvement of Horseradish Peroxidase upon Modification of Accessible Lysines: Experiments and Simulation

    Biophysical Journal 92(4):1192 (2007)

    Horseradish peroxidase (HRP) is an important heme enzyme with enormous medical diagnostic, biosensing, and biotechnological applications. Thus, any improvement in the applicability and stability of the enzyme is potentially interesting. We previously reported that covalent attachment of an ...
  14. Potent modulation of the voltage-gated sodium channel Nav1.7 by OD1, a toxin from the scorpion Odonthobuthus doriae.

    Molecular Pharmacology 70(1):405 (2006) PMID 16641312

    Voltage-gated sodium channels are essential for the propagation of action potentials in nociceptive neurons. Nav1.7 is found in peripheral sensory and sympathetic neurons and involved in short-term and inflammatory pain. Nav1.8 and Nav1.3 are major players in nociception and neuropathic pain, re...
  15. Structural and functional characterization of a mutant of Pseudocerastes persicus natriuretic peptide.

    Protein & Peptide Letters 13(3):295 (2006) PMID 16515458

    We hereby report on a mutational analysis of a novel natriuretic peptide (PNP), recently isolated by us from the Iranian snake venom. The PNP variant (mutPNP) with four substitutions (G16T, K18S, R21S, G23R) and a disulfide bonded ring shortened by 3 residues. mutPNP peptide was expressed in pET...
  16. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels.

    FEBS Letters 579(19):4181 (2005) PMID 16038905

    In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPG...
  17. OD1, the first toxin isolated from the venom of the scorpionOdonthobuthus doriaeactive on voltage-gated Na+channels

    FEBS Letters 579(19):4181 (2005)

    In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPD...
  18. Solution structure of long neurotoxin NTX-1 from the venom of Naja naja oxiana by 2D-NMR spectroscopy.

    European Journal of Biochemistry 271(23-24):4950 (2004) PMID 15606783

    The NMR solution structures of NTX-1 (PDB code 1W6B and BMRB 6288), a long neurotoxin isolated from the venom of Naja naja oxiana, and the molecular dynamics simulation of these structures are reported. Calculations are based on 1114 NOEs, 19 hydrogen bonds, 19 dihedral angle restraints and seco...
  19. Functional and structural characterization of a novel member of the natriuretic family of peptides from the venom of Pseudocerastes persicus.

    FEBS Letters 557(1-3):104 (2004) PMID 14741349

    A novel peptide, PNP (Pseudocerastes persicus natriuretic peptide), was isolated from the venom of the Iranian viper P. persicus. Amino acid sequencing revealed that the 37-residue peptide belongs to the family of natriuretic peptides. The physiological effects of intra-venously PNP infused into...
  20. Functional and structural characterization of a novel member of the natriuretic family of peptides from the venom ofPseudocerastes persicus

    FEBS Letters 557(1):104 (2004)

    A novel peptide, PNP ( P seudocerastes persicus n atriuretic p eptide), was isolated from the venom of the Iranian viper P. persicus. Amino acid sequencing revealed that the 37-residue peptide belongs to the family o...