Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Amphibian Proteins (1):
Recent article
Amphibian Proteins
Abstract
The cationic, alpha-helical frog skin antimicrobial peptide B2RP (brevinin-2-related peptide) shows sequence similarity to antimicrobial peptides belonging to the brevinin-2 family, but lacks the C-terminal cyclic heptapeptide domain (Cys-Lys-Xaa (4)-Cys). Synthetic B2RP produced a significant (p<0....
|
PMID: 20496306
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Abstract
SummaryBufo arenarum oocytes are oviposited surrounded by jelly coats, one component of the extracellular matrix required for fertilization. The secretion, released to the oviductal lumen, was analysed by SDS-PAGE. The coomassie blue staining evidenced an electrophoretic pattern with molecules rangi...
|
PMID: 19500442
PDF is available here.
PDF is available here.
FEBS Journal (276)22 2009
Abstract
Antimicrobial peptides participate in innate host defense by directly eliminating pathogens as a result of their ability to damage the microbial membrane and by providing danger signals that will recruit innate immune cells to the site of infection. Dermaseptin DA4 (DRS-DA4), a new a...
|
PMID: 19843179
PDF is available here.
PDF is available here.
FEBS Journal (276)19 2009
Abstract
We show that esculentin-1b(1-18) [Esc(1-18)] (GIFSKLAGKKLKNLLISG-NH(2)), a linear peptide encompassing the first 18 residues of the full-length esculentin-1b, rapidly kills Escherichia coli at the minimal inhibitory concentration. The lethal event is concomitant with the permeation of the outer and...
|
PMID: 19725877
PDF is available here.
PDF is available here.
Abstract
We observed an increase in the oxidation current as a function of number of Leishmania cells in the electrolytic solution at concentrations down to 10(3) cells/mL. The latter is indicative that the use of AMPs immobilized in electroactive nanostructured films may be of interest for applications in t...
|
PMID: 19215729
PDF is available here.
PDF is available here.
Abstract
In this study the bactericidal effect of the N-terminal fragment of the frog skin peptide esculentin-1b [Esc(1-18)] in combination with clinically used antimicrobial agents was evaluated against Stenotrophomonas maltophilia, either in standard conditions (phosphate buffer) or in the presence of huma...
|
PMID: 19520127
PDF is available here.
PDF is available here.
Abstract
Peptide-based defenses of ranid frogs from Mexico and Central America have been studied in much less detail than those from North America. Peptides belonging to the brevinin-1 (5 peptides), palustrin-2 (1 peptide), and ranatuerin-2 (3 peptides) families were isolated from norepinephr...
|
PMID: 19379837
PDF is available here.
PDF is available here.
Abstract
We have shown that much of this behaviour can be attributed to a cocktail of six proteins, designated ranaspumins (Rsn-1 to Rsn-6), which predominate in the foam. These fall into two discernable classes based on sequence analysis and biophysical properties. Rsn-2, with an amphiphilic amino acid sequ...
|
PMID: 19324764
PDF is available here.
PDF is available here.
Abstract
We show that Msi1 is expressed in mature photoreceptors and retinal pigment epithelium (RPE) cells, and is indispensable for the survival of photoreceptors. We found in the adult newt eye that Msi1 is expressed in all photoreceptors and RPE cells as well as in the retinal stem/progenitor cells in th...
|
PMID: 18662689
PDF is available here.
PDF is available here.
Abstract
We believe that these two peptides are appropriate candidates in the evaluation of newer and safer microbicides spermicides in the future....
|
PMID: 19893636
PDF is available here.
PDF is available here.
Abstract
Data on variability of nucleotide sequences of mitochondrial DNA (mtDNA) cytochrome b gene of Schrenck newt, Salamandrella schrenckii (Strauch, 1870), from populations of Primorie and Khabarovsk regions have been received. By means of phylogenetic analysis, two clusters of haplotypes--'southern' clu...
|
PMID: 19334526
PDF is available here.
PDF is available here.
Abstract
We examined the expression of various neural and muscle markers and found that although all are expressed normally at early stages of development, many are down regulated by the tailbud stage. This suggests that REEP4 plays a role in the maintenance of both the nervous system and the musculature....
|
PMID: 19123125
PDF is available here.
PDF is available here.
Abstract
We have used the ALM to identity the axolotl (Ambystoma mexicanum) orthologue of Twist (AmTwist), a basic helix-loop-helix transcription factor that is involved in the regeneration of the dermis during limb regeneration. AmTwist is expressed during the blastema stages in regeneration, but is inhibit...
|
PMID: 19046162
PDF is available here.
PDF is available here.
Abstract
We describe genetic diversity at a brevinin-1 AMP locus in three species of leopard frogs (Rana pipiens, Rana blairi, and Rana palustris). Several highly divergent allelic lineages are segregating at this locus. That this unusual pattern results from balancing selection is demonstrated by multiple l...
|
PMID: 18799711
PDF is available here.
PDF is available here.
Abstract
We have previously cloned a partial sequence of a peptide cDNA (N1) from an anterior-endoderm-conditioned-medium RNA library that had been shown to be able to rescue the mutant phenotype. In the current studies we have fully cloned the N1 full length cDNA sequence from the library. N1 protein has be...
|
PMID: 18563628
PDF is available here.
PDF is available here.
Abstract
Amphibian peptides which inhibit the formation of nitric oxide by neuronal nitric oxide synthase (nNOS) do so by binding to the protein cofactor, Ca2+calmodulin (Ca2+CaM). Complex formation between active peptides and Ca2+CaM has been demonstrated by negative ion electrospray ionisation mass spectro...
|
PMID: 18853393
PDF is available here.
PDF is available here.
Abstract
Amphibian skin glands are known to secrete various types of bioactive peptides. The array of these peptides is specific for every frog species. The present research deals with the identification of peptides isolated from the skin secretion of the Marsh frog R. ridibunda inhabiting the Kolkhida Canyo...
|
PMID: 18855342
PDF is available here.
PDF is available here.
Abstract
We have made a systematic effort to collect, analyze, and classify all the Phyllomedusid peptide sequences available in databases. We propose that frogs belonging to the Phyllomedusinae subfamily should be described by the species names set out in Amphibian Species of the World: http://research.amnh...
|
PMID: 18644413
PDF is available here.
PDF is available here.
Biophysical Journal (95)8 2008
Abstract
We performed a total of approximately 8 micros of coarse-grained molecular dynamics (CG-MD) simulations of M1.1 in the presence of zwitterionic phospholipid membranes. Several systems were simulated in which the peptide/lipid ratio was varied. At a low peptide/lipid ratio, M1.1 adopted a kinked, mem...
|
PMID: 18641064
PDF is available here.
PDF is available here.
Critical Care Medicine (36)9 2008
Abstract
Lethality, bacterial growth in blood and peritoneum, spleen, liver, and mesenteric lymph nodes All combined regimen showed lower lethality rates than singly treated-groups. Distinctin plus vancomycin or teicoplanin exerted the lowest lethality rate. All regimens were significantly superior to contro...
|
PMID: 18679116
PDF is available here.
PDF is available here.
Biopolymers (89)9 2008
Abstract
Folding propensities of bombinins H2 and H4, two members of amphibian bombinins H, a family of 17-20 residue alpha-helical peptides, have been investigated by means of circular dichroism (CD) measurements and molecular dynamics (MD) simulations. The two peptides, with primary structure IIGPVLGLVGSAL...
|
PMID: 18459169
PDF is available here.
PDF is available here.
Abstract
Appendage regeneration is a complex and fascinating biological process exhibited in vertebrates by urodele amphibians and teleost fish. A current focus in the field is to identify new molecules that control formation and function of the regeneration blastema, a mass of proliferative mesenchyme that...
|
PMID: 18644447
PDF is available here.
PDF is available here.
Abstract
We have identified five new antimicrobial peptide homologs in the defensive skin secretion of the Chinese piebald odorous frog, Huia schmackeri (formerly Rana (Odorrana) schmackeri), by cloning of their respective biosynthetic precursors. As these peptides are obvious homologs of the brevinin-1 and...
|
PMID: 18423796
PDF is available here.
PDF is available here.
Abstract
While conducting experiments to investigate antimicrobial peptides of amphibians living in the Yunnan-Sichuan region of southwest China, a new family of antimicrobial peptides was identified from skin secretions of the rufous-spotted torrent frog, Amolops loloensis. Members of the new peptide family...
|
PMID: 18312859
PDF is available here.
PDF is available here.
Abstract
Our results show that Brevinin-2R activates the lysosomalmitochondrial death pathway, and involves autophagy-like cell death....
|
PMID: 18494941
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1778)6 2008
Abstract
We conducted a quantitative analysis of lipids and proteins of detergent-free low-density membranes isolated from Bufo arenarum oocytes and we modulated cellular cholesterol to further understand how these domains perform their regulatory functions in the amphibian system. Light membranes derive fro...
|
PMID: 18395513
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1784)6 2008
Abstract
Design of clinically valuable antibacterial agents based upon naturally occurring peptides requires the use of spectroscopic methods, particularly NMR, to determine the three-dimensional structure of the native peptide so that analogues with improved therapeutic properties can be made. Ranatuerin-2C...
|
PMID: 18387372
PDF is available here.
PDF is available here.
Molecular Pharmacology (73)5 2008
Abstract
We next investigated the allosteric effect on CRF-stimulated G-protein coupling. Ligands inhibited CRF-stimulated cAMP accumulation regardless of their effect on the G-protein-uncoupled state. The modulators reduced CRF E(max) values, suggesting that they reduced the efficacy of a CRF-bound active s...
|
PMID: 18239030
PDF is available here.
PDF is available here.
Abstract
We have used an assembly PCR method for the fast and extremely accurate synthesis of the brevinin-2R gene. A total of six primers were assembled in a single step PCR, and the assembly was then amplified by PCR to produce the final gene. The synthetic gene was cloned into the pET32a (+) vector to all...
|
PMID: 18401741
PDF is available here.
PDF is available here.
Zoological Science (25)5 2008
Abstract
We cloned by RT-PCR a cDNA from total RNA prepared from the skin of the Japanese brown frog Rana japonica. The cDNA directs the synthesis of a novel, non-C-terminally alpha-amidated peptide composed of 21 amino acid residues (FLGSLIGAAIPAIKQLLGLKK). The putative peptide showed limited sequence simil...
|
PMID: 18558801
PDF is available here.
PDF is available here.
Abstract
Five natural peptides isolated from ranid skin secretions of European frog species of Rana ridibunda and Rana arvalis (molecular masses 3516, 2674, 2636, 1874, and 1810 Da) were studied by MALDI-TOF/TOF to compare two procedures of disulfide bond cleavage: (1) performic oxidation and (2) reduction/c...
|
PMID: 18280749
PDF is available here.
PDF is available here.
Abstract
This study indicates that dermaseptins are antimicrobial molecules that deserve to be tested as topical microbicide with useful associated activities that can add to their prophylaxis, safety and effectiveness....
|
PMID: 18295385
PDF is available here.
PDF is available here.
médecine/sciences (24)3 2008
Abstract
Molecular Immunology (45)3 2008
Abstract
We firstly reported the antimicrobial peptide and its cDNA cloning from skin secretions of the crab-eating frog R. cancrivora. The antimicrobial peptide was named cancrin with an amino acid sequence of GSAQPYKQLHKVVNWDPYG. By BLAST search, cancrin had no significant similarity to any known peptides....
|
PMID: 17707909
PDF is available here.
PDF is available here.
Journal of Neurochemistry (104)4 2008
Abstract
Endogenous expression of the corticotropin-releasing factor type 2a receptor [CRF2(a)] but not CRF2(b) and CRF2(c) was observed in higher passage cultures of human Y79 retinoblastoma cells. Functional studies further demonstrated an increase in CRF2(a) mRNA and protein levels with higher passage num...
|
PMID: 17976162
PDF is available here.
PDF is available here.
Biological Chemistry (389)2 2008
Abstract
We have investigated the insulin-releasing properties and cytotoxicity of the peptide, together with selected analogues with increased cationicity and hydrophobicity. At concentrations in the range 10(-9)-10(-6) m, pseudin-2, and its [Lys18], [Phe8], and [d-Lys3,d-Lys10,d-Lys14] derivatives, stimula...
|
PMID: 18163889
PDF is available here.
PDF is available here.
Abstract
The growing field of skeletal developmental biology provides new molecular markers for the cellular precursors of cartilage and bone. These markers enable resolution of early features of skeletal development that are otherwise undetectable through conventional staining techniques. This study investi...
|
PMID: 18638321
PDF is available here.
PDF is available here.
Abstract
By Sephadex G-50 gel filtration, Resource Q anionic exchange and C4 reversed phase liquid high performance liquid chromatography, a proteinase inhibitor protein (Ranaserpin) was identified and purified from the eggs of the odour frog, Rana grahami. The protein displayed a single band adjacent to the...
|
PMID: 17826205
PDF is available here.
PDF is available here.
Abstract
An extract of the skin of the Japanese tree frog, Hyla japonica Günther, 1859 (Anura: Hylidae) did not inhibit the growth of the bacteria Escherichia coli or Staphylococcus aureus, but contained a protein that was strongly hemolytic against human erythrocytes. The protein was purified to near homog...
|
PMID: 17905622
PDF is available here.
PDF is available here.
Abstract
We compared the in vitro bactericidal activities of five AMPs from three different species of anurans against multidrug-resistant clinical isolates belonging to species often involved in nosocomial infections (Staphylococcus aureus, Enterococcus faecium, Pseudomonas aeruginosa, Stenotrophomonas malt...
|
PMID: 17954700
PDF is available here.
PDF is available here.
Abstract
To study role of ACh in the Ca2+-dependent regulation of rhythm and strength of cardiac contractions in frog Rana temporaria, the ACh chrono- and inotropic effects have been studied in parallel experiments on the background of blockers of potential-controlled Ca2+-channels, ryanodine and muscarine r...
|
PMID: 19198160
PDF is available here.
PDF is available here.
Abstract
Our data also show that increasing the number of positive charges of the peptide resulted in a reduced cytotoxicity without affecting the spermicidal effect. This study indicates that dermaseptins are spermicidal molecules that deserve to be tested as topical contraceptive with useful activities tha...
|
PMID: 17942313
PDF is available here.
PDF is available here.
Abstract
Extended-spectrum beta-lactamase (ESBL)-producing Gram-negative bacteria are becoming increasingly prevalent and their antibiotic resistance necessitates novel therapeutic intervention. Ascaphin-8 is a cationic alpha-helical peptide that shows broad-spectrum antibacterial activity but is also toxic...
|
PMID: 18068868
PDF is available here.
PDF is available here.
Abstract
Peptidomic analysis of an extract of the skins of specimens of Dybowski's brown frog Rana dybowskii Gunther, 1876, collected on Tsushima Island, Japan led to the identification of 10 peptides with differential antibacterial and hemolytic activities. The primary structures of these peptides identifie...
|
PMID: 17688900
PDF is available here.
PDF is available here.
Abstract
The rapid accumulation of defensive transgene products in plants only on pathogen invasion has clear advantages over their constitutive synthesis. In this study, two antimicrobial peptides from the skin secretions of frogs, MsrA2 (N-methionine-dermaseptin B1) and temporin A, were evaluated for engin...
|
PMID: 17645440
PDF is available here.
PDF is available here.
Abstract
We have carried out a comprehensive in vitro analysis of the inhibitory action of these two peptides on the model fungus Saccharomyces cerevisiae. Gene ontology profiling (of biological processes) was used to identify both common and unique effects of each peptide. Resistance to both peptides was co...
|
PMID: 17846143
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1768)11 2007
Abstract
The interactions of the antimicrobial peptides aurein 1.2, citropin 1.1 and maculatin 1.1 with dimyristoylphosphatidylcholine (DMPC), dimyristoylphosphatidylglycerol (DMPG) and dimyristoylphosphatidylethanolamine (DMPE) were studied by differential scanning calorimetry (DSC) and Fourier-transform in...
|
PMID: 17825246
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (282)42 2007
Abstract
We describe the expression, purification, crystallization, and three-dimensional structure determination of zebrafish (Danio rerio) L-BABP to 1.5A resolution, which is currently the highest available for a protein of this family. Since we have found that in zebrafish, the stoichiometry of binding in...
|
PMID: 17670743
PDF is available here.
PDF is available here.
Abstract
Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was activ...
|
PMID: 17561225
PDF is available here.
PDF is available here.
Abstract
This study reports the variety of peptides present in the skin secretory peptidome of Phyllomedusa hypochondrialis azurea. Peptide structures, along with post-translational modifications, were elucidated by QTOF MS/MS analysis, cDNA sequencing, or a combination of both. Twenty-two peptides, includin...
|
PMID: 17696382
PDF is available here.
PDF is available here.
Abstract
The emergence of strains of pathogenic microorganisms with resistance to commonly used antibiotics has necessitated a search for novel types of antimicrobial agents. Many frog species produce amphipathic alpha-helical peptides with broad spectrum antimicrobial activity in the skin but their therapeu...
|
PMID: 17560323
PDF is available here.
PDF is available here.
Abstract
Native ligands stimulated Gs and Gi activation through CRF(1), resulting in stimulation and then inhibition of cAMP accumulation. Single replacements in urocortin at positions 6-15 led, dependent on the position and nature of the substituent, to ligands that conserved Gs activity, but were devoid of...
|
PMID: 17533422
PDF is available here.
PDF is available here.
Differentiation (75)6 2007
Abstract
We examined VegT orthologs from several anuran amphibians and the urodele amphibian, the Mexican axolotl. In addition to the conserved T-box, the DNA-binding domain, the orthologs share a conserved 57 amino acid domain at the C-terminal. Most striking is a 17-nucleotide (nt) sequence near the 3' end...
|
PMID: 17459091
PDF is available here.
PDF is available here.
Molecular Microbiology (65)2 2007
Abstract
The dermaseptins are a family of antimicrobial peptides from the tree-frog Phyllomedusa sauvagii. Yeast exposed to dermaseptin S3(1-16), a truncated derivative of dermaseptin S3 with full activity, showed diagnostic markers of yeast apoptosis: the appearance of reactive oxygen species and fragmentat...
|
PMID: 17587229
PDF is available here.
PDF is available here.
Abstract
Studies conducted on amphibian skin secretions over the past 40 years have isolated and identified huge arrays of bioactive peptides, many of which have demonstrated potent anti-microbial activity. Such peptides are attracting increasing attention due to the growing problem of pathogenic microorgani...
|
PMID: 17553595
PDF is available here.
PDF is available here.
Neuroscience Letters (419)3 2007
Abstract
Opioid agonists produce analgesia in humans and other mammals by binding to three distinct types of G protein-coupled receptors; mu (MOR), delta (DOR), and kappa (KOR) opioid receptors. A fourth member of the opioid receptor family is the nociceptin or orphanin FQ receptor (ORL), however the role of...
|
PMID: 17452077
PDF is available here.
PDF is available here.
Biopolymers (86)1 2007
Abstract
Plasticins (23 long-residue glycine-leucine-rich dermaseptin-related peptides produced by the skin of South American hylids) have very similar amino acid sequences, hydrophobicities, and amphipathicities, but differ in their membrane-damaging properties and structurations (i.e. destabilized helix st...
|
PMID: 17309077
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (282)18 2007
Abstract
We also show that cAMP-dependent [K(+)](gl) elevation prior to the onset of acid secretion generates the osmotic gradient initially driving water into the gastric glands and that CaR activation inhibits this process, probably through reduction of intracellular cAMP levels....
|
PMID: 17363364
PDF is available here.
PDF is available here.
Abstract
Multiple bradykinin-related peptides including a novel bradykinin structural variant, (Val(1))-bradykinin, have been identified from the defensive skin secretion of Guenther's frog, Hylarana guentheri by a tandem mass spectrometry method. Subsequently, four different preprobradykinin cDNAs, which en...
|
PMID: 17321638
PDF is available here.
PDF is available here.
Journal of Neuroscience (27)10 2007
Abstract
We describe a novel corticotropin-releasing factor receptor 1 (CRF1) antagonist with advantageous properties for clinical development, and its in vivo activity in preclinical alcoholism models. 3-(4-Chloro-2-morpholin-4-yl-thiazol-5-yl)-8-(1-ethylpropyl)-2,6-dimethyl-imidazo[1,2-b]pyridazine (MTIP)...
|
PMID: 17344409
PDF is available here.
PDF is available here.