Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Escherichia coli Proteins (4):
Recent article
Escherichia coli Proteins
Abstract
We demonstrate that a single, site-specific, cyclobutane pyrimidine dimer leading-strand template lesion provides only a transient block to fork progression in vitro. The replisome remains stably associated with the fork after collision with the lesion. Leading-strand synthesis is then reinitiated d...
|
PMID: 21998391
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Molecular BioSystems (7)9 2011
Abstract
We developed an integrated proteomic platform with the combination of 2-D native/SDS-PAGE-based proteomics with co-immunoprecipitation, far-Western blotting, His-tag affinity purification and functional analysis, and used it to investigate the E. coli cytosolic complexome. A total of 24 distinct het...
|
PMID: 21717022
PDF is available here.
PDF is available here.
Abstract
We report an isotope labeling shotgun proteome analysis strategy to validate the spectrum-to-sequence assignments generated by using sequence-database searching for the construction of a more reliable MS/MS spectral library. This strategy is demonstrated in the analysis of the E. coli K12 proteome....
|
PMID: 21726074
PDF is available here.
PDF is available here.
PLoS Pathogens (7)6 2011
Abstract
Cyclic dimeric GMP (c-di-GMP) is a bacterial second messenger that modulates many biological processes. Although its role in bacterial pathogenesis during mammalian infection has been documented, the role of c-di-GMP in a pathogen's life cycle within a vector host is less understood....
|
PMID: 21738477
PDF is available here.
PDF is available here.
Current Biology (21)5 2011
Abstract
Dynamic signaling networks are required to perform complex cellular processes. Structural and functional data now indicate the intriguing possibility that extracellular bacterial pathogens use catalytic scaffolds to assemble unique supramolecular signaling networks that effectively s...
|
PMID: 21377097
PDF is available here.
PDF is available here.
Proteomics (11)3 2011
Abstract
Cell surface physicochemical characterization techniques were combined with quantitative changes in protein expression, to investigate the biological and biophysical changes of Escherichia coli MG1655 cells when grown as a biofilm (BIO). The overall surface charge of BIO cells was fo...
|
PMID: 21268264
PDF is available here.
PDF is available here.
Abstract
Escherichia coli DH5α grows poorly in a chemically defined medium, but its acetate-tolerant mutant, DA19, grows fast and produces less acetate. To investigate the differences in metabolism between the two strains, the samples of continuous cultures at steady state were analyzed by t...
|
PMID: 20700606
PDF is available here.
PDF is available here.
Microbial Pathogenesis (49)6 2010
Abstract
Coxiella burnetii, an obligate intracellular Gram-negative bacterium, is the etiological agent of Q fever. This work takes advantage of a hypersensitive Escherichia coli genetic system to identify genes involved in resistance to nitrosative stress imposed by reactive nitrogen intermediates. Among th...
|
PMID: 20705129
PDF is available here.
PDF is available here.
EMBO Journal (29)23 2010
Abstract
We found that, in the rate-limiting intermediate of a chaperonin reaction, the unfolded polypeptide in the cage partly protrudes through a narrow space near the GroEL/GroES interface. Then, the entire polypeptide is released either into the cage or to the outside medium. The former adopts a native s...
|
PMID: 20959808
PDF is available here.
PDF is available here.
Abstract
We show that the CDI growth inhibitory activity resides within the carboxy-terminal region of CdiA (CdiA-CT), and that CdiI binds and inactivates cognate CdiA-CT, but not heterologous CdiA-CT. Bioinformatic and experimental analyses show that multiple bacterial species encode functional CDI systems...
|
PMID: 21085179
PDF is available here.
PDF is available here.
Abstract
We present structural characterization of oxidation intermediates for these demethylases. Using a chemical cross-linking strategy, complexes of AlkB-double stranded DNA (dsDNA) containing 1,N(6)-etheno adenine (εA), N(3)-methyl thymine (3-meT) and N(3)-methyl cytosine (3-meC) are stabilized and cry...
|
PMID: 21068844
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We employed Cys-scanning analysis of the xanthine-specific homolog YgfO from Escherichia coli. Using a functional mutant devoid of Cys residues (C-less), each amino acid residue in sequences (259)FLVVGTIYLLSVLEAVGDITATAMVSRRPIQGEEYQSRLKGGVLADGLVSVIASAV(314) and (342)TIAVMLVILGLFP(354) including thes...
|
PMID: 20802252
PDF is available here.
PDF is available here.
Abstract
These results demonstrate that intranasal inoculation with B. subtilis spore-based rotavirus vaccines is effective in generating protective immunity against rotavirus challenge in mice....
|
PMID: 20810679
PDF is available here.
PDF is available here.
EMBO Journal (29)21 2010
Abstract
We show here that EI and HPr localize near the Escherichia coli cell poles. Polar localization of each protein occurs independently, but HPr is released from the poles in an EI- and sugar-dependent manner. Conversely, the β-glucoside-specific permease, BglF, localizes to the cell membrane. EI, HPr...
|
PMID: 20924357
PDF is available here.
PDF is available here.
Abstract
We isolated several new LolCDE mutants that cause outer membrane localization of lipoproteins possessing LolCDE-avoidance signals. Mutations were found in all three subunits of LolCDE, including the cytoplasmic ATPase subunit LolD. However, the extent of outer membrane sorting of inner membrane-spec...
|
PMID: 20888319
PDF is available here.
PDF is available here.
Abstract
We extend such work to flexible, multidomain proteins and one of the most widespread membrane transporter families, the major facilitator superfamily, thus showing that more complex membrane proteins can be successfully refolded to recover native substrate binding. We determine the unfolding free en...
|
PMID: 20937906
PDF is available here.
PDF is available here.
EMBO Journal (29)20 2010
Abstract
We compared intracellular responses mediated by both types of ligands and developed a new mathematical model for signalling by indirectly binding ligands. We show that indirect binding allows cells to better control sensitivity to specific ligands in response to their nutrient environment and to coo...
|
PMID: 20834231
PDF is available here.
PDF is available here.
Abstract
Extracellular DNA (eDNA) is a structural component of the polymeric matrix of biofilms from different species. Different mechanisms for DNA release have been proposed including lysis of cells, lysis of DNA-containing vesicles, and DNA secretion. Here, a genome-wide screen of 3985 non-lethal mutation...
|
PMID: 20833130
PDF is available here.
PDF is available here.
Abstract
We report the crystal structure of FucP at 3.1 Å resolution, which shows that it contains an outward-open, amphipathic cavity. The similarly folded amino and carboxyl domains of FucP have contrasting surface features along the transport path, with negative electrostatic potential on the N domain...
|
PMID: 20877283
PDF is available here.
PDF is available here.
Abstract
These results indicate that PriA is involved in the discontinuous synthesis of nascent DNA....
|
PMID: 19823946
PDF is available here.
PDF is available here.
Abstract
We describe the crystal structures of the inner-membrane transporter CusA in the absence and presence of bound Cu(I) or Ag(I). These CusA structures provide new structural information about the HME subfamily of RND efflux pumps. The structures suggest that the metal-binding sites, formed by a three-...
|
PMID: 20865003
PDF is available here.
PDF is available here.
Abstract
We examined the role of 2 effectors, Tir and NleB, and the structural translocator component EspA in the adherence of STEC to epithelial cells and in the colonization of cattle. Isogenic deletion mutants were constructed and using microscopy and flow cytometry compared to the wild-type strain in the...
|
PMID: 20921984
PDF is available here.
PDF is available here.
Abstract
We cover our current understanding of the structure, assembly, function, and regulation of bacterial actins. We focus on ParM as a well-understood reductionist model and on MreB as a central organizer of multiple aspects of bacterial cell biology. We also discuss the outstanding puzzles in the field...
|
PMID: 20630996
PDF is available here.
PDF is available here.
Abstract
Avian pathogenic Escherichia coli (APEC) is an important respiratory pathogen of poultry. A variety of virulence-associated genes and serogroups are associated with avian colibacillosis caused by APEC strains. One hundred forty-eight E. coli isolates recovered from diagnosed cases of...
|
PMID: 20618074
PDF is available here.
PDF is available here.
Abstract
We provide evidence for an important role of actin reorganization in pemphigus pathogenesis. In parallel to loss of cell adhesion and fragmentation of Dsg3 staining along cell borders, PV-IgG treatment resulted in striking changes in actin cytoskeleton organization. Moreover, in experiments using fl...
|
PMID: 20554911
PDF is available here.
PDF is available here.
Abstract
We have developed an interpolated elastic network model to generate a transition pathway between the two protein conformations. For validation, we have predicted the order of local and global conformational changes during key ATP-driven transitions in three important biological nanomachines (myosin,...
|
PMID: 20602461
PDF is available here.
PDF is available here.
Abstract
The Shiga-like toxins (Stx) are critical virulence factors of enterohaemorrhagic Escherichia coli (EHEC). Stx1B subunit plays important roles in EHEC infection. This work aims to generate and characterize monoclonal antibodies (mAbs) against the Stx1B and to investigate their utility in discriminati...
|
PMID: 20854398
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)33 2010
Abstract
We report that Gsp-modified proteins from E. coli contain mixed disulfides of Gsp and protein thiols, representing a new type of post-translational modification formerly undocumented. The level of these proteins is increased by oxidative stress. We attribute the accumulation of such proteins to the...
|
PMID: 20530482
PDF is available here.
PDF is available here.
Abstract
We describe a link between transposition of IS608 and ISDra2, both members of the IS200/IS605 family, which uses obligatory single-stranded DNA intermediates, and the host replication fork. Replication direction through the IS plays a crucial role in excision: activity is maximal when the "top" IS s...
|
PMID: 20691900
PDF is available here.
PDF is available here.
Abstract
We measured the effects of various mutations introduced to the L2 loop's region (residues 228-238) on the stability of HtrA molecule and its proteolytic activity. We demonstrated that most mutations affected the activity of HtrA. In the case of the following substitutions: L229N, N235I, I238N, the p...
|
PMID: 20515644
PDF is available here.
PDF is available here.
Abstract
Our results indicate that the OpdA Tyr(607) residue plays an important role in the enzyme-substrate interaction and in the hydrolytic activity.
2010 Elsevier Inc. All rights reserved....
|
PMID: 20513640
PDF is available here.
PDF is available here.
Abstract
Abstract
We carried out quantitative system-wide analyses of protein and mRNA expression in individual cells with single-molecule sensitivity using a newly constructed yellow fluorescent protein fusion library for Escherichia coli. We found that almost all protein number distributions can be described by the...
|
PMID: 20671182
PDF is available here.
PDF is available here.
Abstract
Of the 97 patients diagnosed with ESBL-producing E. coli bacteremia, six were excluded owing to incomplete follow-up and missing data. Comparisons were made between 91 patients and their controls. Multivariate analysis identified urinary catheterization [odds ratio (OR) = 6.21, 95% confidence interv...
|
PMID: 20688291
PDF is available here.
PDF is available here.
Abstract
In Escherichia coli, the lsr operon is composed of six genes lsrACDBFG which regulate uptake and modification of the signalling molecule AI-2. LsrR is a repressor of the lsr operon and itself, which can bind phospho-AI-2 and be released from the promoter region of the operon and thus activate gene e...
|
PMID: 20693666
PDF is available here.
PDF is available here.
Abstract
The main aim of this study was to determine the frequency of antibiotic resistance among Escherichia coli isolates recovered in Levine agar plates from 54 fecal samples of captive ostriches from a farm in the South of Portugal. Fifty-four nonselected E. coli isolates were obtained (one/sample) and t...
|
PMID: 20367084
PDF is available here.
PDF is available here.
Abstract
We showed that an Escherichia coli O157:H7 strain that was unable to form biofilm was retained in large numbers in dual-strain biofilms formed with an E. coli O-:H4 companion strain. In this study we tested additional companion strains for their ability to retain E. coli O157:H7 strain 0475s. Compan...
|
PMID: 20367070
PDF is available here.
PDF is available here.
Biotechnology Letters (32)8 2010
Abstract
Expression of four reference genes of grass carp, including beta-actin (ACTB), glyceraldehyde-3-phosphate dehydrogenase (GAPDH), 18S rRNA (18S) and elongation factor-1 alpha (EF1alpha), was studied in tissues of normal individuals and bacteria-infected individuals. EF1alpha had the most stable expre...
|
PMID: 20361234
PDF is available here.
PDF is available here.
Abstract
We investigated the cytotoxicity and interaction with intestinal tissues of an SF, Shiga-toxin-negative E. coli O157:NM isolate. This bovine isolate was negative for stx genes and was not cytotoxic for Vero cells. We found that this E. coli O157 isolate possesses an intimin of type beta, whereas the...
|
PMID: 20482230
PDF is available here.
PDF is available here.
Abstract
We have developed quality assessment methods, which predict real value of the global and local quality of protein structure models. The global quality of a model is defined as the root mean square deviation (RMSD) and the LGA score to its native structure. The local quality is defined as the distanc...
|
PMID: 20525730
PDF is available here.
PDF is available here.
Journal of Medical Microbiology (59)Pt 8 2010
Abstract
Extended-spectrum beta-lactamases (ESBLs) are bacterial enzymes that confer resistance to advanced generation cephalosporins and can lead to therapeutic failures. There has been no analysis of factors associated with the risk of acquisition of ESBLs in neonates in an intensive care unit from norther...
|
PMID: 20430903
PDF is available here.
PDF is available here.
FEMS Microbiology Letters (309)1 2010
Abstract
We have characterized a DeltarodZ mutant and show that defective peptidoglycan synthesis might be the primary effect of the deletion. A motile pseudorevertant of DeltarodZ isolated possessed a near rod-shaped cell morphology, indicating that RodZ is not absolutely required for the elongation of the...
|
PMID: 20528937
PDF is available here.
PDF is available here.
FEMS Microbiology Letters (309)1 2010
Abstract
We find that when the strains being compared have the same thyA allele (wild type or mutant), flhD mutations have no effect on growth....
|
PMID: 20546312
PDF is available here.
PDF is available here.
Genetika (Moskva) (46)8 2010
Abstract
The key elements of the regulatory system activating expression of the lux-operon genes in the sea bacteria Vibrio fischeri are the LuxR protein (an activator oftranscription) and N-(3-oxohexanoyl) L-homoserine lactone (an autoinducer, AI). It is shown that the ATP-dependent proteases ClpXP and Lon...
|
PMID: 20873201
PDF is available here.
PDF is available here.
Infection and Immunity (78)8 2010
Abstract
We describe a subunit vaccine against ExPEC which is based on immunodominant epitopes of the virulence-associated ExPEC proteins FyuA, IroN, ChuA, IreA, Iha, and Usp. Using a novel approach of computer-aided design, two completely artificial genes were created, both encoding eight peptide domains de...
|
PMID: 20498257
PDF is available here.
PDF is available here.
Infection and Immunity (78)8 2010
Abstract
We examined the role of conserved residues located in the SPATE beta-barrel-forming region in passenger domain secretion. Thirty-nine fully conserved residues in Tsh were mutated by single-residue substitution, and defects in their secretion phenotypes were assessed by cell fractionation and immunoc...
|
PMID: 20515934
PDF is available here.
PDF is available here.
Infection and Immunity (78)8 2010
Abstract
We examine the organization of clathrin in pedestals and report that CD2AP, an endocytosis-associated and cortactin-binding protein, is a novel and important component of EPEC pedestal formation that also utilizes Y474 phosphorylation of EPEC Tir. We also demonstrate the successive recruitment of Nc...
|
PMID: 20515931
PDF is available here.
PDF is available here.
Marine Biotechnology (12)4 2010
Abstract
We expressed an Escherichia coli nitroreductase (Ntr) gene in the male germ line of zebrafish. The Ntr gene encodes an enzyme that can convert prodrugs such as metronidazole (Met) to cytotoxins. A fusion protein eGFP:Ntr (fusing Ntr to eGFP) under control of approximately 2 kb putative promoters of...
|
PMID: 19936986
PDF is available here.
PDF is available here.
Abstract
The ZIP (ZRT-, IRT-like Protein) protein ZupT from Escherichia coli is a transporter with a broad substrate range. Phenotypic and transport analysis showed that ZupT, in addition to Zn(II), Fe(II) and Co(II) uptake, is also involved in transport of Mn(II) and Cd(II). Competition experiments with oth...
|
PMID: 20225068
PDF is available here.
PDF is available here.
Abstract
Two free flavin-independent enzymes were purified by detecting the NAD(P)H oxidation in the presence of Fe(III)-EDTA and t-butyl hydroperoxide from E. coli. The enzyme that requires NADH or NADPH as an electron donor was a 28 kDa protein, and N-terminal sequencing revealed it to be oxygen-insensitiv...
|
PMID: 20407804
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)15 2010
Abstract
We used site-directed mutagenesis to study the importance of different regions of the E. coli ClyA protein for export and activity. The data indicate that ClyA translocation to the periplasm requires several protein segments located closely adjacent to each other in the "tail" domain of the ClyA mon...
|
PMID: 20511497
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)15 2010
Abstract
We found a ternary complex for the repressed purA promoter also. These findings, together with the backwards orientation of repressed marboxes, suggested a unique interaction of MarA with RNAP in repression. However, no repression-specific residues of MarA could be found among 38 single-alanine repl...
|
PMID: 20453091
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)30 2010
Abstract
We provide both genetic and biochemical evidence that the Lon protease and the SecB and DnaJ/Hsp40 chaperones are involved in the quality control of presecretory proteins in Escherichia coli. We showed that mutations in the lon gene alleviate the cold-sensitive phenotype of a secB mutant. Such suppr...
|
PMID: 20504766
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)30 2010
Abstract
We have previously shown that the mutagenic potential of DinB is regulated by the DNA damage response protein UmuD(2). In the current study, we employ a pre-steady-state fluorescence approach to gain a mechanistic understanding of DinB regulation by UmuD(2). Our results suggest that DinB, like its m...
|
PMID: 20467052
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)29 2010
Abstract
We show that lipoylated enzymes present in the bacterial extracts of Xylella fastidiosa interacted physically and functionally with this Cys-based peroxidase, whereas thioredoxin and glutathione systems failed to support Ohr peroxidase activity. Furthermore, we could reconstitute in vitro three lipo...
|
PMID: 20463026
PDF is available here.
PDF is available here.
Abstract
We synthesized a gene encoding the LTB adapted to the optimized coding sequences in plants and fused to the endoplasmic reticulum retention signal SEKDEL to enhance its expression level and protein assembly in plants. The synthetic LTB gene was located into a plant expression vector under the contro...
|
PMID: 20176109
PDF is available here.
PDF is available here.
Abstract
We initially explored whether MBP would have the same effect in the methylotrophic yeast Pichia pastoris, a popular eukaryotic host for heterologous protein expression. When MBP was fused as an N-terminal partner to several C-terminal cargo proteins expressed in this yeast, proteolysis occurred betw...
|
PMID: 20230898
PDF is available here.
PDF is available here.
Abstract
The aim of this study was to determine the role of host factors and bacterial virulence genes in the development of pyelonephritis caused by Escherichia coli in renal transplant (Tx) recipients.
A total of 328 E. coli isolates from cases of cystitis (Cys; n=239) or py...
|
PMID: 20448070
PDF is available here.
PDF is available here.
Nature Methods (7)7 2010
Abstract
We developed a polymer-based enrichment approach to profile protein C-terminal peptides by mass spectrometry and identified hundreds of C-terminal peptides in the Escherichia coli proteome. We isotopically labeled GluC protease-digested and undigested samples and identified GluC substrates and their...
|
PMID: 20526347
PDF is available here.
PDF is available here.
Journal of Medical Microbiology (59)Pt 7 2010
Abstract
Colonization factor antigens (CFAs) are important virulence factors in enterotoxigenic Escherichia coli (ETEC). Using a multiplex PCR and RT-PCR, this study tested the presence of common colonization factor-encoding genes and their expression in 50 ETEC strains isolated from stool specimens. The sam...
|
PMID: 20299505
PDF is available here.
PDF is available here.