Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Escherichia coli K12 (0):
Recent article
Escherichia coli K12
Abstract
We describe a synthetic genetic circuit that couples cell density and motility. This system enabled programmed Escherichia coli cells to form periodic stripes of high and low cell densities sequentially and autonomously. Theoretical and experimental analyses reveal that the spatial structure arises...
|
PMID: 21998392
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Journal of Biological Chemistry (285)52 2010
Abstract
We proposed that FtsY requires functional interaction with inner membrane lipids at a late stage of the signal recognition particle pathway. In addition, an essential lipid-binding α-helix was identified in FtsY of various origins. Theoretical considerations and in vitro studies have suggested that...
|
PMID: 20956528
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We employed Cys-scanning analysis of the xanthine-specific homolog YgfO from Escherichia coli. Using a functional mutant devoid of Cys residues (C-less), each amino acid residue in sequences (259)FLVVGTIYLLSVLEAVGDITATAMVSRRPIQGEEYQSRLKGGVLADGLVSVIASAV(314) and (342)TIAVMLVILGLFP(354) including thes...
|
PMID: 20802252
PDF is available here.
PDF is available here.
Abstract
The tannery effluents at Kanpur (India) have been in use for irrigation since last many years, polluting soil directly while ground water and food crops indirectly. Gas chromatography-mass spectrometric analysis of the test samples revealed the presence of organic compounds including diisooctyl phth...
|
PMID: 20684992
PDF is available here.
PDF is available here.
Clinical Immunology (137)1 2010
Abstract
We employed in vitro and in vivo models of sepsis to investigate the functional relationship between overtly produced C5a and IL-8. Our data revealed that C5a could strongly amplify IL-8 expression from human whole blood cells induced by LPS and other types of TLR agonists. ERK1/2 and p38, but not J...
|
PMID: 20591742
PDF is available here.
PDF is available here.
Abstract
These results suggest that monoassociated mice might be used as a tool for characterizing niches occupied by the intestinal flora and potentially as a method of targeting the evolution of bacteria for applications in biotechnology....
|
PMID: 20472724
PDF is available here.
PDF is available here.
Archives of Microbiology (192)7 2010
Abstract
The role of the genomic bipyrimidine nucleotide frequency in pyrimidine dimer formation caused by germicidal UV radiation was studied in three microbial reference organisms (Escherichia coli K12, Deinococcus radiodurans R1, spores and cells of Bacillus subtilis 168). The sensitive HPLC tandem mass s...
|
PMID: 20454780
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Abstract
I demonstrate that cooperation between species can be evolved in the laboratory if (1) there is preexisting reciprocation or feedback for cooperation, and (2) reciprocation is preferentially received by cooperative genotypes. I used a two species system involving Salmonella enterica ser. Typhimurium...
|
PMID: 20100214
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)14 2010
Abstract
FNR-dependent activation of the Escherichia coli K-12 nrf promoter is downregulated by the nitric oxide-sensitive NsrR protein together with the nucleoid-associated protein IHF, which bind to overlapping targets adjacent to the DNA site for FNR. The NsrR target is inactivated by mutation at the Salm...
|
PMID: 20472787
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)13 2010
Abstract
We show that overproduction of CreD in a Cet2 strain results from hyperactivation of the CreBC two-component regulator, but CreD overproduction is not responsible for the Cet2 phenotype. Through microarray analysis and gene knockout and overexpression studies, we show that overexpression of another...
|
PMID: 20418396
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)14 2010
Abstract
We describe a new member of this signaling cascade, an LTTR heretofore renamed QseD (quorum-sensing E. coli regulator D). QseD is present in all enterobacteria but exists almost exclusively in O157:H7 isolates as a helix-turn-helix (HTH) truncated isoform. This "short" isoform (sQseD) is still able...
|
PMID: 20494990
PDF is available here.
PDF is available here.
Abstract
We investigated (i) the impact of SWNT concentration on cell growth and biofilm formation, (ii) toxic effects of SWNTs on mature biofilms, and (iii) formation of biofilm on SWNT-coated surfaces. The results show that at the initial stage of biofilm formation, SWNTs come into contact with bacterial c...
|
PMID: 20465305
PDF is available here.
PDF is available here.
Abstract
We have developed a new localization-based imaging technique achieving almost isotropic subdiffraction resolution in 3D. A tilted mirror is used to generate a side view in addition to the front view of activated single emitters, allowing their 3D localization to be precisely determined for superreso...
|
PMID: 20472826
PDF is available here.
PDF is available here.
Abstract
We have discovered that the cryptic endonuclease activity reported for the isolated C-terminal domain of the transposase MuA [Wu Z, Chaconas G (1995) A novel DNA binding and nuclease activity in domain III of Mu transposase: Evidence for a catalytic region involved in donor cleavage. EMBO J 14:3835-...
|
PMID: 20167799
PDF is available here.
PDF is available here.
Abstract
The staphylococcal enterotoxin H (SEH; 217 aa, 25 kD) belongs to a family of superantigens that cause a massive immune response upon simultaneous binding to the T cell receptor (TCR) and the major histocompatibility complex class II. The SEH-TCR interaction is weak and amenable to studies using NMR...
|
PMID: 19888679
PDF is available here.
PDF is available here.
Genetika (Moskva) (46)3 2010
Abstract
MG1655 of Escherichia coli K-12 is frequently used in metabolic engineering as the wild-type strain. However, its two mutations, ilvG and rph-1 provide a negative effect on culture growth. The "polar effect" of rph-1 decreases the level of pyrE expression, causing partial auxotrophy for pyrimidines....
|
PMID: 20391779
PDF is available here.
PDF is available here.
Journal of Bacteriology (192)4 2010
Abstract
We combined bioinformatics and experimental data to identify guanine deaminase as the enzyme responsible for this biotransformation. The ammeline degradation phenotype was demonstrated in wild-type Escherichia coli and Pseudomonas strains, including E. coli K12 and Pseudomonas putida KT2440. Bioinfo...
|
PMID: 20023034
PDF is available here.
PDF is available here.
Abstract
I foot-printings confirmed the ability of the intragenic promoter located approximately 280 bp downstream of ATG to bind RNA polymerase. Primer extension revealed the cDNA of the expected size while Northern blot hybridization assumes the presence of aRNA among cellular RNAs. Relative abundance of a...
|
PMID: 20608174
PDF is available here.
PDF is available here.
Abstract
We tested the reaction to different carbon sources entering at various points of central metabolism. In all cases, the applied substrates (glucose, succinate, acetate, and pyruvate) were immediately utilized by the cells. Extracellular rates and metabolome data indicate a metabolic steady state duri...
|
PMID: 19785030
PDF is available here.
PDF is available here.
Abstract
Mass spectrometric studies are now playing a leading role in the elucidation of lipopolysaccharide (LPS) structures through the characterization of antigenic polysaccharides, core oligosaccharides and lipid A components including LPS genetic modifications. The conventional MS and MS/MS analyses toge...
|
PMID: 20589944
PDF is available here.
PDF is available here.
Abstract
PykF is one of two pyruvate kinases in Escherichia coli K-12. lambdaP(L) was convergently integrated into the chromosome of the MG1655 strain, downstream of pykF, face-to-face with its native promoter. In the presence of lambdacIts857, efficient pykF ts-silencing was achieved when the 5'-terminus of...
|
PMID: 20068353
PDF is available here.
PDF is available here.
Abstract
The effect of high glucose concentration on the transcription levels of the small RNA SgrS and the messenger RNA ptsG, (encoding the glucose transporter IICBGlc), was studied in both E. coli K-12 (MG1655 and JM109) and E. coli B (BL21). It is known that the transcription level of sgrS increases when...
|
PMID: 20920177
PDF is available here.
PDF is available here.
Biochemistry (Washington) (48)39 2009
Abstract
We report an examination of the self-association properties of the E. coli ClpA protein unfoldase through the application of analytical ultracentrifugation and light scattering techniques, including sedimentation velocity, sedimentation equilibrium, and dynamic light scattering approaches. In contra...
|
PMID: 19650643
PDF is available here.
PDF is available here.
Abstract
Presence of pathogens in high numbers in waste water is a cause of concern. Techno economic feasibility has restricted the conventional and non conventional treatment approaches for pathogen removal. Despite prolific use, carbon adsorption technology remains an expensive treatment process. The prese...
|
PMID: 20136040
PDF is available here.
PDF is available here.
Genetika (Moskva) (45)9 2009
Abstract
The recessive radioresistance allele gam12 cloned in plasmid pBC4042-gam12 slightly increases the radiation resistance of Escherichia coli wild-type cells. Meanwhile, irradiation by gamma-rays induces transition of r12 mutation to the homozygous state and causes a 3.37-fold increase in radiation res...
|
PMID: 19824539
PDF is available here.
PDF is available here.
Abstract
Four novel hexakis C60 derivatives with varying functionalities were synthesized, and their photochemical properties and photodynamic disinfection efficiencies were quantitatively evaluated. All these C. derivatives generated O2 more efficiently than commercial multihydroxylated C60 (fullerol), as a...
|
PMID: 19764224
PDF is available here.
PDF is available here.
Biochemistry (Washington) (48)33 2009
Abstract
We address the long-standing but enigmatic observation that unliganded MBP is also able to stimulate MalFGK(2). Although the mechanism of this stimulation is not understood, it is sometimes attributed to a small amount of closed (but unliganded) MBP that may exist in solution. To gain insight into h...
|
PMID: 19630440
PDF is available here.
PDF is available here.
Abstract
We fractionated the lipids of Escherichia coli B and analyzed the fractions using negative-ion electrospray ionization mass spectrometry to reveal unknown lipid structures. Analysis of a fraction eluting with high salt from DEAE cellulose revealed a series of ions not corresponding to any of the kno...
|
PMID: 19096047
PDF is available here.
PDF is available here.
Abstract
This study investigated residual bacteria and different food types left on tableware items after various washing and sanitization protocols. Escherichia coli K-12 and Staphylococcus epidermidis were inoculated into whole milk and soft cream cheese. The milk was used to contaminate regular drinking g...
|
PMID: 19610348
PDF is available here.
PDF is available here.
Biofouling (25)5 2009
Abstract
The influence of type 1 fimbriae, mannose-sensitive structures, on biofilm development and maturation has been examined by the use of three isogenic Escherichia coli K12 strains: wild type, fimbriated, and non-fimbriated. Experiments with the three strains were done in minimal medium or Luria...
|
PMID: 19306144
PDF is available here.
PDF is available here.
Abstract
We clarified the molecular mechanism of the transcriptional cascade of acid resistance and multidrug resistance genes initiated by the EvgS/EvgA two-component system in Escherichia coli, followed by sequential induction of the transcriptional regulators, YdeO and GadE. Overexpression of EvgA, the re...
|
PMID: 19352034
PDF is available here.
PDF is available here.
Abstract
Our results suggest that the aloe sample could inhibit infectious diseases by stimulating the host defense mechanism, especially the phagocytic and killing activities of macrophages....
|
PMID: 19352017
PDF is available here.
PDF is available here.
FEMS Microbiology Letters (293)1 2009
Abstract
We used a tripartite approach to investigate mechanisms by which pH affects cadmium toxicity that included analyses of: (1) growth kinetics, (2) global gene expression, and (3) cadmium speciation. Cadmium extended the lag phase at pH 7, but not at pH 5. DNA microarray analysis revealed that stress r...
|
PMID: 19220470
PDF is available here.
PDF is available here.
FEMS Microbiology Letters (293)1 2009
Abstract
We show evidence of evolution within single-species biofilms in real time. Escherichia coli harvested from 22-day-old biofilms express a competitive advantage over cells incubated in biofilms for shorter periods of time. This advantage is manifested as the ability of aged cells to outcompete younger...
|
PMID: 19239496
PDF is available here.
PDF is available here.
Microbiology (155)Pt 4 2009
Abstract
Deletions leading to complete or partial removal of ParB were introduced into the Pseudomonas aeruginosa chromosome. Fluorescence microscopy of fixed cells showed that ParB mutants lacking the C-terminal domain or HTH motif formed multiple, less intense foci scattered irregularly, in contrast to the...
|
PMID: 19332810
PDF is available here.
PDF is available here.
Methods in Molecular Biology (532)532 2009
Abstract
We discuss a simple theoretical analysis based on the in silico artificial addition of known foreign genes from different prokaryotic groups into the genome of Escherichia coli K12 MG1655. Using this dataset as a control, we have tested the efficiency of four methodologies commonly employed to detec...
|
PMID: 19271187
PDF is available here.
PDF is available here.
Abstract
Collagenous colitis presents with significantly increased uptake and altered mucosal reactivity to nonpathogenic bacteria. Budesonide induces clinical remission and restores mucosal reactivity but does not abolish the increased bacterial uptake. An underlying barrier dysfunction may explain the freq...
|
PMID: 19209166
PDF is available here.
PDF is available here.
Abstract
We have investigated the properties of a suspected hotspot for the integration of the mariner Mos1 element, namely the Tn9 cat gene that encodes a chloramphenicol acetyl transferase. Using in vitro and bacterial transposition assays, we confirmed that the cat gene is a preferential target for MOS1 i...
|
PMID: 19112581
PDF is available here.
PDF is available here.
Abstract
We found that 5-FU does not decrease biofilm formation of the cells that lack AriR, a global DNA regulator that controls acid resistance in E. coli. Hence, 5-FU represses biofilm formation of E. coli K-12 through AriR and is a novel antivirulence compound for this strain....
|
PMID: 19172264
PDF is available here.
PDF is available here.