Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Cell Membrane (6):
Recent article
Cell Membrane
British Journal of Nutrition (104)12 2010
Abstract
Dietary fish oil modulates skeletal muscle membrane fatty acid composition. Similar changes in heart membrane composition modulate myocardial oxygen consumption and enhance mechanical performance. The rat in vivo autologous perfused hindlimb was used to investigate the influence of membrane composit...
|
PMID: 20691135
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Abstract
We used three-dimensional super-resolution fluorescence microscopy (interferometric photoactivated localization microscopy) to map nanoscale protein organization in focal adhesions. Our results reveal that integrins and actin are vertically separated by a ∼40-nm focal adhesion core region consisti...
|
PMID: 21107430
PDF is available here.
PDF is available here.
EMBO Journal (29)23 2010
Abstract
We report the structure of a Ca(2+)/CaM Ca(V)1.2 C-terminal tail complex that contains two PreIQ helices bridged by two Ca(2+)/CaMs and two Ca(2+)/CaM-IQ domain complexes. Sedimentation equilibrium experiments establish that the complex has a 2:1 Ca(2+)/CaM:C-terminal tail stoichiometry and does not...
|
PMID: 20953164
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1802)12 2010
Abstract
The epithelial Na(+) channel (ENaC) is a major regulator of salt and water reabsorption in a number of epithelial tissues. Abnormalities in ENaC function have been directly linked to several human disease states including Liddle syndrome, psuedohypoaldosteronism, and cystic fibrosis and may be impli...
|
PMID: 20347969
PDF is available here.
PDF is available here.
Journal of Antibiotics (63)12 2010
Abstract
Our results suggest that the fungicidal activity of AmB combined with allicin is involved in vacuole disruption but not in potassium ion efflux, and that the expression of allicin-mediated activity of AmB requires the presence of ergosterol in the plasma membrane....
|
PMID: 20940723
PDF is available here.
PDF is available here.
Abstract
This article describes efforts to build a model biological membrane at a surface of a gold electrode. In this architecture, the membrane may be exposed to static electric fields on the order of 10(7) to 10(8) V m(-1). These fields are comparable in magnitude to the static electric field acting on a...
|
PMID: 20852809
PDF is available here.
PDF is available here.
Abstract
We have characterized the activity of γ-secretase complexes under a variety of detergent solubilization and reconstitution conditions, and the structural state of proteoliposomes by electron microscopy. We found that γ-secretase activity is highly dependent on the physical state or integrity of th...
|
PMID: 20937251
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We employed Cys-scanning analysis of the xanthine-specific homolog YgfO from Escherichia coli. Using a functional mutant devoid of Cys residues (C-less), each amino acid residue in sequences (259)FLVVGTIYLLSVLEAVGDITATAMVSRRPIQGEEYQSRLKGGVLADGLVSVIASAV(314) and (342)TIAVMLVILGLFP(354) including thes...
|
PMID: 20802252
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We found that plasma membrane targeting to mimic persistent Ras activation enhanced the growth-transforming activities of RalGEFs. Unexpectedly, transforming activity did not correlate directly with total cell steady-state levels of Ral activation. Next, we observed elevated Rgl2 expression in PDAC...
|
PMID: 20801877
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (285)45 2010
Abstract
We examined the effect of indomethacin on membrane lateral heterogeneity. Fluorescence lifetime imaging of cells expressing lipid-anchored probes revealed that treatment of BHK cells with therapeutic levels of indomethacin enhances cholesterol-dependent nanoclustering, but not cholesterol-independen...
|
PMID: 20826816
PDF is available here.
PDF is available here.
Abstract
EMBO Reports (11)11 2010
Abstract
We report that Grb14 interacts with the rod photoreceptor-specific cyclic-nucleotide-gated channel alpha subunit (CNGA1) and decreases its affinity for cyclic guanosine monophosphate. Channel modulation is controlled by direct binding of the Grb14 Ras-associating domain with the carboxy-terminal reg...
|
PMID: 20890309
PDF is available here.
PDF is available here.
Abstract
G protein-coupled receptors (GPCRs) are expressed throughout the nervous system where they regulate multiple physiological processes, participate in neurological diseases, and are major targets for therapy. Given that many GPCRs respond to neurotransmitters and hormones that are pres...
|
PMID: 20632972
PDF is available here.
PDF is available here.
Cell Biology International (34)11 2010
Abstract
We show that KLK induces an increase of the intracellular Ca²(+) concentration in human T24 cells. The effect of KLK is buffer-sensitive, as it is detected when HBSS buffer is used, but not with PBS. This, together with the lack of effect of the middle leucine-to-proline-substituted peptide derivat...
|
PMID: 20695847
PDF is available here.
PDF is available here.
Abstract
We show that mutations disrupting the scaffolding function do not impair endocytosis, whereas those disrupting membrane bending cause significant defects. By anchoring endophilin to the plasma membrane, we show that endophilin acts prior to scission to promote endocytosis. Despite acting at the plas...
|
PMID: 21029864
PDF is available here.
PDF is available here.
Trends in Cell Biology (20)11 2010
Abstract
Recent evidence suggests that the major pathways mediating cell cholesterol homeostasis respond to a common signal: active membrane cholesterol. Active cholesterol is the fraction that exceeds the complexing capacity of the polar bilayer lipids. Increments in plasma membrane cholesterol exceeding th...
|
PMID: 20843692
PDF is available here.
PDF is available here.
Bioresource Technology (101)22 2010
Abstract
I and III to the Langmuir isothermal adsorption. Less than half of phenanthrene is transported into E. coli, where more than 60% are located in the cytoplasm. About 60% of anthracene entered the E. coli where only 10% was released into the cytoplasm. The partition coefficients of phenanthrene and an...
|
PMID: 20643544
PDF is available here.
PDF is available here.
Abstract
We have used phagocytosis as a paradigm of signal transduction, taking advantage of the generous size of phagosomes and of their comparatively leisurely rate of formation. Aided by the design of specific probes, we demonstrated a highly localized and elegantly choreographed sequence of changes in th...
|
PMID: 20739621
PDF is available here.
PDF is available here.
EMBO Journal (29)21 2010
Abstract
We show here that EI and HPr localize near the Escherichia coli cell poles. Polar localization of each protein occurs independently, but HPr is released from the poles in an EI- and sugar-dependent manner. Conversely, the β-glucoside-specific permease, BglF, localizes to the cell membrane. EI, HPr...
|
PMID: 20924357
PDF is available here.
PDF is available here.
Abstract
Our results confirm that the detection of sublethal injury in the outer membrane after PEF may contribute to the identification of the treatment conditions under which PEF may act synergistically with hydrophobic compounds such as citral.
Knowledge about the mechanism of microbial inactivation by PE...
|
PMID: 21039664
PDF is available here.
PDF is available here.
Abstract
We isolated several new LolCDE mutants that cause outer membrane localization of lipoproteins possessing LolCDE-avoidance signals. Mutations were found in all three subunits of LolCDE, including the cytoplasmic ATPase subunit LolD. However, the extent of outer membrane sorting of inner membrane-spec...
|
PMID: 20888319
PDF is available here.
PDF is available here.
Journal of Antibiotics (63)11 2010
Abstract
We show that attachment of a C8 alkyl chain to ring III of a neamine-based aminoglycoside specifically at the 4″-o position yields a broad-spectrum fungicide (FG08) without the antibacterial properties typical for aminoglycosides. Leaf infection assays and greenhouse studies show that FG08 is capa...
|
PMID: 20924381
PDF is available here.
PDF is available here.
Journal of Antibiotics (63)11 2010
Abstract
Abstract
We report that ErbB2-induced repression of glycogen synthase kinase-3 (GSK3) activity, mediated by Memo and mDia1, is required for MT capture and stabilization. Memo-dependent inhibition of GSK3 allows the relocalization of APC (adenomatous polyposis coli) and cytoplasmic linker-associated protein 2...
|
PMID: 20937854
PDF is available here.
PDF is available here.
Abstract
We report a transporter, Nrat1 (Nramp aluminum transporter 1), specific for trivalent Al ion in rice. Nrat1 belongs to the Nramp (natural resistance-associated macrophage protein) family, but shares a low similarity with other Nramp members. When expressed in yeast, Nrat1 transports trivalent Al ion...
|
PMID: 20937890
PDF is available here.
PDF is available here.