Find your PDFs fast.
Welcome to the Pubget Medical Subject Headings (MESH) browser. Click on a topic or subtopic below to explore related papers. In the gold box is the most recent paper about the current MESH term, and below are 20 related papers.
Diacylglycerol Kinase (0):
Recent article
Diacylglycerol Kinase
Abstract
We previously showed that Src mediates growth factors-induced activation of Dgk-alpha, whose activity is required for cell motility, proliferation and angiogenesis. Here, we demonstrate that both hepatocytes growth factor (HGF) stimulation and v-Src transformation induce tyrosine phosphorylation of...
|
PMID: 17700527
PDF is available here.
PDF is available here.
| < More recent | Older article > |
Molecular Psychiatry (13)2 2008
Abstract
We have carried out a genome-wide association study of bipolar disorder by genotyping over 550,000 single-nucleotide polymorphisms (SNPs) in two independent case-control samples of European origin. The initial association screen was performed using pooled DNA, and selected SNPs were confirmed by ind...
|
PMID: 17486107
PDF is available here.
PDF is available here.
Circulation Journal (72)2 2008
Abstract
These results demonstrate the first evidence that DGK zeta blocks cardiac dysfunction and progression to lethal HF by activated G alpha q protein without detectable adverse effects in the in-vivo heart and suggest that DGK zeta is a novel therapeutic target for HF....
|
PMID: 18219172
PDF is available here.
PDF is available here.
Biochemical Journal (409)2 2008
Abstract
We have demonstrated the molecular mechanism of DGKdelta-mediated regulation of clathrin-dependent endocytosis that controls the internalization, recycling and degradation of receptors. Involvement of DGKdelta in the regulation of clathrin-dependent endocytosis was previously proposed following geno...
|
PMID: 17880279
PDF is available here.
PDF is available here.
New Phytologist (178)2 2008
Abstract
The role of phosphoinositide-specific phospholipase C (PI-PLC) signaling in the macrotubule-dependent protoplast volume regulation in plasmolyzed root cells of Triticum turgidum was investigated. At the onset of hyperosmotic stress, PI-PLC activation was documented. Inhibition of PI-PLC activity by...
|
PMID: 18221245
PDF is available here.
PDF is available here.
Abstract
We examined transgenic mice with cardiac-specific overexpression of DGKzeta (DGKzeta-TG) compared to wild type (WT) mice in streptozotocin-induced (STZ, 150 mg/kg) diabetic and nondiabetic conditions. After 8 weeks, decreases in heart weight and heart weight/body weight ratio in diabetic WT mice wer...
|
PMID: 18241357
PDF is available here.
PDF is available here.
Abstract
We raised the question of its regulation by sphingolipid messengers. Using chemical and genetic methods, we have shown by GFP-LC3 staining and analysis of the degradation of long-lived proteins that both ceramide and S1P stimulate autophagy....
|
PMID: 18425450
PDF is available here.
PDF is available here.
Abstract
We focus primarily on the nuclear localization, modulation of intrinsic enzymatic activity, and the potential physiological roles of the six diacylglycerol kinases that have been found in the nucleus: DGK-alpha, DGK-gamma, DGK-delta, DGK-zeta, DGK-iota, and DGK-theta....
|
PMID: 17981572
PDF is available here.
PDF is available here.
Abstract
Abstract
Biochemical Journal (409)1 2008
Abstract
We found that PMA and H2O2 also induced the interaction of DGKgamma with beta2-chimaerin. It is noteworthy that simultaneous addition of PMA and H2O2 synergistically enhanced the interaction. In this case, PMA was replaceable by DAG (diacylglycerol). The beta2-chimaerin translocation from the cytopl...
|
PMID: 17803461
PDF is available here.
PDF is available here.
Biochemical Journal (409)1 2008
Abstract
DGKs (diacylglycerol kinases) are members of a unique and conserved family of intracellular lipid kinases that phosphorylate DAG (diacylglycerol), catalysing its conversion into PA (phosphatidic acid). This reaction leads to attenuation of DAG levels in the cell membrane, regulating a host of intrac...
|
PMID: 18062770
PDF is available here.
PDF is available here.
Biochemistry (Washington) (46)49 2007
Abstract
We suggest that the 2,3-dioleoylglycerol binds to a site on the alpha and zeta isoforms of diacylglycerol kinase that is exposed as a consequence of the substrate binding to the active site. The chiral specificity of these enzymes thus mimics the substrate specificity, with MuLK being the least sele...
|
PMID: 18004883
PDF is available here.
PDF is available here.
Abstract
We previously showed that hepatocyte growth factor (HGF), vascular endothelial growth factor, and anaplastic lymphoma kinase activate Dgkalpha in endothelial and leukemia cells through a Src-mediated mechanism and that activation of Dgkalpha is required for chemotactic, proliferative, and angiogenic...
|
PMID: 17898083
PDF is available here.
PDF is available here.
Abstract
Understanding the intercellular and intracellular mechanisms that maintain anergy and prevent the induction of full effector function is one avenue that may allow us to manipulate immune responses. Recent studies of T cell receptor (TCR)-proximal signaling events in different models of T cell unresp...
|
PMID: 17949964
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (282)48 2007
Abstract
We studied the functional role of the DGKalpha domains using mutational analysis to investigate membrane binding in intact cells. We show that the two atypical C1 domains are essential for plasma membrane targeting of the protein in intact cells but unnecessary for catalytic activity. We also identi...
|
PMID: 17911109
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (282)47 2007
Abstract
We describe the crystal structures of the NAD kinase (LmNADK1) from Listeria monocytogenes in complex with its substrate NAD, its product NADP, or two synthesized NAD mimics. We identified one of the NAD mimics, di-adenosine diphosphate, as a new substrate for LmNADK1, whereas we showed that the clo...
|
PMID: 17686780
PDF is available here.
PDF is available here.
Journal of Biological Chemistry (282)44 2007
Abstract
We show that exposure of L6 myotubes overexpressing human insulin receptors to 25 mm glucose for 5 min decreased the intracellular levels of diacylglycerol (DAG). This was paralleled by transient activation of diacylglycerol kinase (DGK) and of insulin receptor signaling. Following 30-min exposure,...
|
PMID: 17675299
PDF is available here.
PDF is available here.
FASEB Journal (21)12 2007
Abstract
We previously reported that nuclear DGK-zeta expression increased during myogenic differentiation, whereas its down-regulation impaired differentiation. Here, we evaluated the possible involvement of nuclear DGK-zeta in cell cycle progression of C2C12 myoblasts. Overexpression of a wild-type DGK-zet...
|
PMID: 17488950
PDF is available here.
PDF is available here.
Abstract
We recently found that sphingosine is an antagonist for SF1 and inhibits cyclic AMP (cAMP)-dependent CYP17 gene transcription. The aim of the current study was to identify phospholipids that bind to SF1 and to characterize the mechanism by which ACTH/cAMP regulates the biosynthesis of this molecule(...
|
PMID: 17664281
PDF is available here.
PDF is available here.
Biochimica et Biophysica Acta (1768)10 2007
Abstract
We have prepared a peptide corresponding to this hydrophobic segment of DGKepsilon of sequence KKKKLILWTLCSVLLPVFITFWKKKKK-NH(2). Flanking Lys residues mimic the natural setting of this peptide in DGKepsilon, while facilitating peptide synthesis and characterization. Circular dichroism and fluoresce...
|
PMID: 17669357
PDF is available here.
PDF is available here.
Biochemistry (Washington) (46)38 2007
Abstract
We show that fluorescence spectroscopy can be used to define the ends of TM alpha-helices. Diacylglycerol kinase (DGK) from Escherichia coli contains three transmembrane (TM) alpha-helices per monomer. We have used fluorescence techniques to define the region of the putative first TM helix (TM1) tha...
|
PMID: 17722884
PDF is available here.
PDF is available here.
Pharmacology & Therapeutics (115)3 2007
Abstract
Diacylglycerol (DAG) kinase (DGK) phosphorylates and converts DAG to phosphatidic acid. DGK regulates cellular DAG levels and attenuates DAG signaling. The 10 mammalian DGK isoforms have been identified to date. In cardiac myocytes, DGKalpha, epsilon, and zeta are expressed, and DGKzeta is the predo...
|
PMID: 17659347
PDF is available here.
PDF is available here.
Abstract
Diacylglycerol kinases (DGKs) are emerging as key negative regulators of immune function, particularly in T cells. DGKs consume diacylglycerol to produce phosphatidic acid. Because both diacylglycerol and phosphatidic acid are important activators of signaling molecules, DGKs have the potential to m...
|
PMID: 17684297
PDF is available here.
PDF is available here.
Abstract
We investigated in the present study a role of DGK on glucose transport in skeletal muscle cells. PCR study showed that C2C12 myotubes expressed DGKalpha, delta, epsilon, zeta, or theta isoform mRNA. R59022, a specific inhibitor of DGK, significantly increased glucose transport, p38 and MKK3/6 activ...
|
PMID: 17588539
PDF is available here.
PDF is available here.